slot banyak bonus new member-🎖️macau303 android|XOXE88.COM

PutriCandrawathi(kanan)diMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,DEPOK-IstriIrjenFerdySambo,PutriCandrawathitakkuasamenahantangissaatmemberikanketerangankepadamedia,didepanMarkasBrigadeMobilKepolisianNegaraRepublikIndonesia,KelapaDua,KotaDepok,JawaBarat,Minggu(7/8)malam.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601slot banyak bonus new member050029114-0);});BuPutribersamasalahsatuanaknyadandidampingiArmanHanis(kuasahukumBuPutridanPakFerdy)datangkeMarkasBrimobdenganmaksudhatimenjengukFerdySambo.Namun,keinginanPutriCandrawathimelihatFerdytakkesampaian.BacaJuga:PutriCandrawathi DatangkeMakoBrimob,BicaraCintaTuluskepadaIrjenFerdySamboSebelumberanjakdariKelapaDua,BuPutritampakberusahamenguatkandiriberbicaradidepankameraparapemburuberita.SayaPutri,bersamaanak-anak,sayamemercayaidantulusmencintaisuamisaya,katanya.WajahPutritertutupmaskerputih,tetapiterlihatmatanyasembapdanairmataturunmembasahipipi.BacaJuga:AdayangAnehdariFotoPakFerdySambodanParfumBuPutriCandrawathi?BuPutrimenangis.Sayamohondoaagarkamisekeluargadapatmenjalanimasayangsulitini,dansayaikhlasmemaafkansegalaperbuatanyangkamidankeluarga(meng)alami,tuturPutri.

KetuaKomnasHAMRIAhmadTaufanDamanikbicarasoalpengusutankasuskematianBrigadirJ.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-KetuaKomnasHAMAhmadTaufanDamanikmemberikanpernyataanmengejutkanterkaitpengungkapankasustewasnyaNofriansyahYosuaHutabaratatauBrigadirJ,Jumat(5/8/2022).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TaufanmenilaiadaupayadaripihaktertentuyangmenginginkanBharadaEmenanggungsendirikasuspolisitembakpolisidirumahmantanKadivPropamIrjenFerdySambotersebut.KomnasHAMmelihatadalangkah-langkahsepertimengupayakannantiBharadaEyangmenanggungsendirikasustersebut.BacaJuga:Ada2JenderaldiSampingJohanChristySaatMenerimaKenaikanPangkatLuarBiasa,SiapaDia?Indikasikuatbahwamemangadalangkah-langkahyangdikatakansebagaiobstractionofjusticebegitu,kataDamanikdalamdiskusivirtualberjudulMenguakKasusKematianBrigadirJ,Jumat(5/8).DiakemudianmenyinggungtentanghasilrekamanCCTVyangsempathilangdandilanjutdenganpemeriksaanbeberapaperwirakepolisian.AlumnusUniversitasSumateraUtara(USU)itumendugapersoalanCCTVtersebutdilakukandemimenumbalkanBharadaEsebagaitersangkatunggaldalamkasustewasnyaBrigadirJ.BacaJuga:PerempuanBerparasAyuIniDitangkapPolisi,KasusnyaMemalukanSayabelumbisabukalangkah-langkahyangmemangsepertinyanantiBharadaEsajayangmenanggungsemuaini,jelasDamanik.PolisimenetapkanBharadaEsebagaitersangkakasuspenembakanBrigadirJ.TersangkapenipuandenganmodussebagaiPNS.Foto:dokcurupekspressjpnn.com,CURUP-EG(40),wargaKotaLubuklinggau,SumselpadaSelasa(2/8)sore,takberkutiksaatdiamankanSatreskrimKepolisianResor(Polres)RejangLebong.EGditangkapkarenadidugamenipudanmenggelapkansepedamotor.Moduspelakumengelabuikorbannyadenganmengakusebagaipegawainegerisipil(PNS).BacaJuga:PublikDimintaBerhentiBerspekulasiLiarPadaKasusBrigadirJPelakumengelabuikorbandenganmenggunakanseragamPNSwarnacoklat.Saatmenjalankanaksinya,EGberpura-purameminjamsepedamotorkorbandenganalasanadakeperluan.Korbanyangmerasapercayakarenapelakumemakaiseragamdanlangsungmeminjamkanmotornya.Namun,justrumotorkorbantidakkembali,ucapKapolresRejangLebongAKBPTonnyKurniawan,Jumat.BacaJuga:MamaMudaDigarapPolisi,JaringannyaInternasional,Berat!PelakudiamankandiLubuklinggauBarat.KepadapetugaspelakumengakutelahmenjalankanaksinyatersebutsudahtigakalidiCurup.AksiterakhirpadaKamisdiPerumahanGrahaAlGazi,DesaTasikmalaya,Curup.slot banyak bonus new member

slot banyak bonus new member-🎖️macau303 android|XOXE88.COM

KapolriJenderalListyoSigitPrabowomengungkapperkembanganterkinikasuspembunuhanBrigadirJdiBareskrimPolri,Kamis(4/8/2022)malam.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KapolriJenderalListyoSigitPrabowomelakukanscientificcrimeinvestigationataupenyidikanberbasisilmiahpadakasustewasnyaBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Menanggapihalitu,pengamatintelijenNgasimanDjoyonegorosangatmengapresiasilangkahkapolritersebut.Diamengatakankapolrijugatelahbersikapresponsif,transparan,tegas,danindependendalampenanganankasuspolisitembakpolisitersebut.BacaJuga:PerempuanBerparasAyuIniDitangkapPolisi,KasusnyaMemalukanKapolriselalumenyampaikanbahwapembuktianyangdilakukanuntukmencarikebenaranmateriilatassuatutindakpidanaselaluberdasarpadascientificcrimeinvestigationsebagaiupayapenguatanalatbuktidalampenangananperkarapidana,termasukdalamkasusmeninggalnyaBrigadirJ,kataNgasimandalamketeranganyangditerimadiJakarta,Jumat(5/7/2022).PenyidikanberbasisilmiahmerupakanlangkahListyoSigitsebagaibentukpertanggungjawabankepadapublikbahwahasilpenyidikankasustersebutbenar-benartransparandandapatdibuktikansecarailmiah.Polrimenghimpunberbagaimacamahli,mulaidariunsurbiologi,kimiaforensik,balistikforensik,ITForensik,hinggakedokteranforensik,sehinggaunsur-unsurilmiahdaripembuktiankasuspidanatersebutbisaterpenuhi.BacaJuga:TanteTinaBerbuatTerlarang,KeponakanDiam-DiamMasukKamarSebelah,UjungnyaPahitKomitmenketerbukaandanketegasansepertiinilahyangdibutuhkanuntukmembangunstabilitaskeamanandimasayangakandatang.SayaoptimistissikapyangdiambilolehKapolriakanmeningkatkanintegritas,independensi,dankepercayaanpublikpadainstitusi,jelasnya.ScientificcrimeinvestigationmerupakansalahsatudariempatlangkahstrategisyangdiambilListyoSigitPrabowo.PengacaraKamaruddinSimanjuntakpertanyakankeberadaanbajuyangdipakaiBrigadirJsaatdibantaikarenabelumpernahdiperlihatkanpenyidik.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-PengacarakeluargaBrigadirJ,KamaruddinSimanjuntakmempertanyakankeberadaanbajuyangdipakaimendiangNofryansahYosuaHutabaratsaattewasdirumahdinasIrjenFerdySambo,Jakarta,Jumat(8/7).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sebab,kataKamaruddin,polisibelumpernahmengungkapbajuyangdipakaianggotaBrimobitusaatdinyatakantewas.Palingsederhana,bajudarialmarhumketikadia(BrigadirJ,red)dibantaibelumpernahdiperlihatkan,katadiadalamdiskusivirtualberjudulMenguakKasusKematianBrigadirJ,Jumat(5/8).BacaJuga:SetelahPeriksa10HPTerkaitKasusBrigadirJ,KomnasHAMUngkapFaktaSoalFoto&ChatSelainbaju,KamaruddinturutmempertanyakankeberadaantigaponselmendiangBrigadirJ.PolisimemangpernahmenyebutadaponselmilikBrigadirJdisita.Hanyasaja,KamaruddinraguponseltersebutmemangmilikajudanIrjenFerdySamboitu.BacaJuga:PembunuhanBrigadirJ:AnalisisRezasoalKodeSenyap,AdaPeranSeniorPonselnyatiga,sampaisekarangbelumdiperlihatkan,malahsayadengarponselyangdisitaituponselyangbarudibeli,bukanponselyangsesungguhnya,kataKamaruddin.AlumnusUniversitasKristenIndonesia(UKI)kemudianturutmempertanyakanalasankamerapengintaiatauclosedcircuittelevision(CCTV)yangsempathilang.KomnasHAMdianggapmenjadijurubicaraPolridalamkasuskematianBrigadirJakibatbakutembakdenganBharadaEdirumahIrjenFerdySambo.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-KomnasHAMhinggakinitidakbisamenyimpulkanterjadiperistiwapelecehanseksualsebelumNofryansahYosuaHutabaratatauBrigadirJtslot banyak bonus new memberewasdirumahdinasIrjenFerdySambo,Jakarta,Jumat(8/7).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sebelumnya,polisimengeklaimBrigadirJtewasdalambakutembaksetelahanggotaBrimobitumelecehkanPutriCandrawathi,istriIrjenFerdySambo.KetuaKomnasHAMAhmadTaufanDamanikmenyebutsejumlahsaksiturutdiperiksapihaknyadalammengungkapkasustewasnyaBrigadirJ.BacaJuga:KomnasHAMCurigaAdayangMenghalangiPengungkapanKasusTewasnyaBrigadirJ,IndikasinyaKuat Namun,katadia,KomnasHAMtidakmenemukansaksiyangsecarajelasmelihatperistiwapelecehanseksualolehajudanIrjenFerdySambo.Makanya,kamijugabelumbisameyakiniapaterjadipelecehanseksualatautidak,ujarDamanikdalamdiskusivirtualberjudulMenguakKasusKematianBrigadirJ,Jumat(5/8).DiamenyebutsaksiyangdimintaiketeranganKomnasHAMhanyamendengarteriakandariPutriyangdidugamengalamipelecehanseksual,tetapitidakmelihat.BacaJuga:KomnasHAMSebutKasusKematianBrigadirJMakinTerangBenderang,IniPenjelasannyaAdapun,saksiyangmendengarteriakanPutriialahRichardEliezeratauBharadaEdenganRiki.TolongRichardtolongRiki,karenaadaRikisatulagiitu,kemudianRichardiniturunkebawahketemudenganYosua,ungkapDamanik.ForkopimdaJemberturunkelokasipembakarandiDesaMulyorejo,KecamatanSilo,KabupatenJember,Kamis(4/8/2022).ANTARA/HO-PolresJemberjpnn.com,JEMBER-PoldaJawaTimurmengerahkanpuluhananggotaBrimobkeDesaMulyorejo,KabupatenJember.Desatersebutdibakarolehorangtakdikenalsehinggarumahdansejumlahkendaraanwargahangus.Kamimendapatbantuanpersonelsebanyak60anggotaBrimobPoldaJatimdilokasiterjadinyapembakaranbeberaparumahwargadiDusunBabanTimur,DesaMulyorejo,KecamatanSilo,kataKabagOpsPolresJemberKompolMTohasaatdikonfirmasi,Jumat(4/8).BacaJuga:PembakaranRumahTerjadiLagi,SuasanaDesaMulyorejoJemberSangatMencekamPerwiramenengahPolriitujugamenyampaikanpihaknyamendapatbantuanpuluhanpersoneldariPolresBanyuwangi.ParapersoneldisiagakanmembantupengamanandiperbatasanJember-Banyuwangi,yaknidiKecamatanKalibaru.Selainitu,TimJatanrasDirektoratReserseKriminalUmumPoldaJatimjugamembantuPolresJemberdalamupayapenindakan,katadia.BacaJuga:MahfudMDBeriPeringatanTegasuntukPelakuPembakaranHutan,JanganMain-mainKasiHumasPolresJemberIptuBrisanImanullamengatakanpihaknyamendatangitempatkejadianperkara(TKP)danmemerintahkananggotareskrimuntukmelakukanpenyelidikan.Sabharamendapattugasmelakukanpengamanandenganmendirikanposko.KomisionerKomnasHAMMohammadChoirulAnamseusaimemintaketerangandaritimkhususPolridantimsiberdiJakarta,Jumat(5/8/2022).Foto:ANTARA/MuhammadZulfikar/pri.jpnn.com,JAKARTA-TimsiberPolritelahmemeriksa10teleponseluler(handphone)terkaittewasnyaNofriansyahaliasBrigadirJdirumahdinasmantanKadivPropamIrjenFerdySambopada8Juli2022lalu.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomisiNasionalHakAsasiManusia(KomnasHAM)RImengakutelahmendapatpenjelasansecaradetaildariPolrimengenai10teleponseluler(handphone)yangtelahdiperiksatersebut.KeteranganyangdidapatkanKomnasHAMjugaberkaitaneratdengankonstrainwaktuyangsejakawaldidapatkanolehlembagaHAMtersebutsaatmenemuikeluargaBrigadirJdiJambi.BacaJuga:KomnasHAMSebutKasusKematianBrigadirJMakinTerangBenderang,IniPenjelasannyaTimsibersudahmengumpulkan15handphonedan10diantaranyasudahdiperiksa.Sementaralimalagisedangdianalisa,kataKomisionerKomnasHAMBekaUlungHapsaradiJakarta,Jumat.Iamengatakanberdasarkanpermintaanketerangandaritimsiber,KomnasHAMmendapatkanfoto,dokumen,kontak,akun,termasuksejakkapanpercakapandilakukan.Termasuktemuandigitallainnya,kataBeka.BacaJuga:IrjenFerdySamboDicopotKapolri,KompolnasBicarasoalKonflikKepentinganSelainitu,kepadaKomnasHAM,timsiberjugamemperlihatkansejumlahdokumenadministrasipenyelidikan.Terakhir,lembagaitumendapatkansejumlahrawmaterial(bahandasar)soalpercakapan.Hasilpaparanberupapercakapan,foto,dokumen,kontakdanlainsebagainyaakandianalisalebihlanjutolehKomnasHAM.

PelatihLiverpoolJurgenKloppsaatmemberikaninstruksikepadaanakasuhnya.Foto:Twitter/EmiratesFACupjpnn.com,LIVERPOOL-LiverpoolditerpakabarburukjelangmelakonilagaperdanaPremierLeaguekontraFulham.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});DuelFulhamvsLiverpoolakanberlangsunghariini,Sabtu(6/8/2022),diCravenCottage.Jelanglagaini,PelatihLiverpoolJurgenKloppharusmemutarotakkarenatimnyadihantuibadaicedera.BacaJuga:TimnasU-16IndonesiavsVietnam:BimaSaktiAkanMelakukanRotasi,Kenapa?SekembalinyadariturpramusimEropa,LiverpoolharusmendapatiDiogoJota,Alex-OxladeChamberlain,AlissonBecker,NabyKeita,danCurtisJonesmengalamicederasecarabergantian.Terkini,Liverpooljugakembalikehilanganpemainintinya,yakniIbrahimaKonatekarenamengalamimasalahpadalutunya.Praktis,hinggaseharijelangkickoffmelawanFulham,hanyaKeitadanAllisonyangsudahkembalifit,sementarayanglainmasihdalamtahappemulihan.BacaJuga:PSISvsBaritoPutera:DejanAntonicUngkapKondisiPemain,SiapCuri3Poin?CederanyaKonate,bahkandisebut-sebutbakalmempengaruhipergerakanLiverpooldibursatransfer.Sebab,bekasalPrancisitudiprediksiabsencukuplama.MungkincederanyaKonateakanmempengaruhstrategikamidibursatransfer.Namun,halitutidakbisamenyeleasikanmasalahkamibegitusaja.IrjenFerdySambosaattibadigedungBareskrimPolri,Jakarta,Kamis(4/8),untukmenjalanipemeriksaanterkaitkasuskematianBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangJumat(5/8)tentangfaktaterbarusoalkasusBrigadirJterungkapmelaluikeraguanKomnasHAM,KapolriinginmasalahFerdySambocepatempatperwiraditahan,hinggasosokyangmengambilCCTVdirumahFerdySamboternyatasudahdiamankan.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.IrjenFerdySamboTampakKurus,Tua,danLelah,BagaimanaIbuPutri?BacaJuga:5BeritaTerpopuler:ProfilFerdySamboDikuliti,BharadaEBukaMulut,HebohDaftarNamaTerungkapIrjenFerdySambopadaKamis(4/8)memenuhipanggilanpenyidikBareskrimPolriuntukdimintaiketerangansebagaisaksikasuskematianBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.FerdySambodatangmengenakanpakaiandinasharian(PDH)lengkapPolridengantandapangkatjenderalbintangdua.Nyaristidakpernahnongoldihadapanpubliksejakinsidenpolisitembakpolisidirumahdinasnya,lulusanAkademiKepolisian(Akpol)pada1994itutampaklebihkurus.BacaJuga:5BeritaTerpopuler:MisteriHilangnyaPakaian&HPBrigadirJDiungkap,AdaBolongBekasTembakan?Bacaselengkapnya,kliklinkdibawah:IrjenFerdySamboTampakKurus,Tua,danLelah,BagaimanaIbuPutri?KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.

TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.

MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.

slot banyak bonus new member-🎖️macau303 android|XOXE88.COM

PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenteriKoordinatorBidangPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDinginagarBhayangkaraDuaRichardEliezeratauBharadaEmendapatperlindungan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudmendorongPolriagarmemfasilitasiLembagaPerlindunganSaksidanKorban(LPSK)untukmemberikanperlindungankepadaBharadaE.Melaluimimbarini,sayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberikanperlindungankepadaBharadaE,agardiaselamatdaripenganiayaanatauapapun,sehinggapendampingandariLPSKitudiaturdengansedemikianrupaagarnantiBharadaEbisasampaikepengadilandanmemberikanketerangandipengadilan,kataMahfuddalamkonferensiperssebagaimanadipantaumelaluikanalYouTubeKemenkoPolhukamdiJakarta,Selasa.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanMahfudmengapresiasipengacaraBharadaE,yakniDeolipaYumarayangmengomunikasikansecarabaikmengenaihal-halyangsebenarnyadialamiolehkliennya.Sebelumnya,Rabu(3/8),PolritelahmenetapkanBharadaEsebagaitersangkadalamkasuskematianBrigadirYoshuaHutabaratatauBrigadirJ.Sampaihariini,selainBharadaE,Polrijugatelahmenetapkanbeberapatersangkalainnya,yaituBripkaRR,KM,danmantanKadivPropamPolriIrjenFerdySambo.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuKeempatnyadisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.Dalamkesempatanyangsama,MahfudpunmengatakansegeramenyampaikankepadaPolriagarkeluargaBrigadirJdiberikanperlindungansecaraprofesional.Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.

TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitralandHotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).

Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.

slot banyak bonus new member-🎖️macau303 android|XOXE88.COM

GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaik 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.

LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.IstriIrjenFerdySambo,PutriCandrawathi.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTASELATAN-PutriCandrawathi,istriIrjenFerdySamboturutmenyaksikansaatpenyidiktimkhusus(timsus)PolrimenggeledahrumahpribadinyadiRT07RW02JalanSaguling,KompleksPertambangan,DurenTiga,Pancoran,JakartaSelatan(Jaksel),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ketuarukuntanggasetempat,YosefmengatakanPutrihanyamenangisketikapenyidikmenggeledah.Iya,diamenangisterusdikamar,susahkamiberkomunikasi,kataYosefdikutipdariAntara,Rabu(10/8).BacaJuga:KPKBelumBisaUmumkanHartaKekayaanIrjenFerdySambo,AdaApa?YosefmengatakandirinyadimintaikuthadirdalamprosespenggeledahanbersamatimkhususpadaSelasa.KetikaitukeadaanPutriterlihatbaik-baiksajanamunpengacaramenyebutnyamenangisterusdidalamkamar.Yosefmengakumelihatadabeberapaorangyaknipengacara,polisiwanita(polwan),danBareskrimikutdalamprosespenggeledahanselamasembilanjam.BacaJuga:BenarkahPutriCandrawathiMengalamiPelecehanSeksual?IniKataKabareskrimAdajugakeduaanakFerdySambodanPutriyakniseoranganakperempuandananaklelakinyapalingkecilberumur1,5tahunbersamapengasuhnyajugaberadadidalamrumah.KeluargaFerdySambotinggaldirumahtersebutkuranglebihsetahunsehinggabelumterlalumengenalkawasanJalanSaguling.ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,KabupatenBekasi,JawaBarat,yangmerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.ANTARA/HO-PolresSerangjpnn.com,SERANG-ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,Bekasi,JawaBarat.DiadidugamerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.PelakuperampokanituberinisialIB(29)wargaBekasi,kataKapolresSerangAKBPYudhaSatriadiSerang,Rabu(10/8).PeristiwaperampokanterjadipadahariSabtu(6/8)pukul22.30WIB.Saatitu,tokobarututupdansejumlahkaryawansudahpulang.BacaJuga:4MalingMotorDiringkusPolisi,PengakuanMerekaMencengangkanPelakuyangmenggunakantopengdangolokitulangsungmenerobosmasuktokolewatpintubelakang.PelakumasukdanlangsungmenodongkangolokkekorbandanmengeluarkanplastikagarkorbanmemasukkanHPdanuang,kataYudha.PemiliktokoNH(41)pasrahmenghadapiancamanperampokyangakanmembacoknya,kemudianmenyerahkanuangRp100jutakedalamkantongplastik.Padasaatitu,pelakumemintakorbanagarmenyerahkanseluruhhandphone.Namunkorbanmenyebutkanbahwaseluruhponselsudahdimasukkankedalambrankas.Pelakuhanyamendapatkanuanglalukeluartokodanmenguncikorbandariluar,kataYudhaSatria.BacaJuga:PerampokBersenpidiApotekMedanAmbrukDiterjangTimahPanas,Bravo,PakPolisiPerampokBersenjatadiApotekDitembakPolisiDalammengungkapkasusitu,polisihanyamembutuhkanwaktuempathari.PolisimenangkapIBditempatkerjanya,Selasa(9/8).Darihasilpenggeledahan,kataYudha,petugasmengamankansejumlahbarangbukti,antaralainsatuunitHondaVario,duacincinemas,duaponsel,sertasejumlahalatuntukmerampok.(antara/jpnn)BeritaSelanjutnya:IdentitasPerampokyangMenewaskanSopirTaksiOnlineSudahDikantongi,Siap-SiapSajaBekRealMadrid,DavidAlaba(jerseiputih)saatmelawanpemainEintrachtFrankfurt(jerseihitam)difinalUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridmenasbihkandirinyasebagaiRajaEropasetelahmempermalukanEintrachtFrankfurtdifinalUEFASuperCup2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Duagolyangmasing-masingdilesatkanolehDavidAlaba(37)danKarimBenzema(65)membawaMadridunggul2-0padalagayangdihelatdiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB.JalannyaPertandinganBacaJuga:PengamatMintaPSMMakassarWaspadaiKualaLumpurCityFC,IniPemicunyaMadridlangsungtancapgassejakmenitawal.JawaraLigaChampionsituterusmencecarpertahananFrankfurtselakukampiunLigaEuropa.Namun,Madridbarubisamembukakeunggulanpadamenit37.UmpandariCasemiromampudituntaskanmenjadigololehAlabasehinggapapanskorberubahmenjadi1-0hinggaturunminum.Dalamkeadaantertinggal,FrankfurtberupayauntukmenekanMadrid.Akantetapi,skortetaptidakberubah.ElRealtetapmemimpin1-0.BacaJuga:BawaIndonesiakeFinalPialaAFFU-162022,BimaSaktiKokMintaMaaf,AdaApa?Padababakkedua,Madridtampakmasihlebihmendominasi.FrankfurtmasihsajakesulitanmenembuspertahanananLosBlancosyangdikawalduetDavidAlabadanEderMilitao.Madridkemudianmenambahkeunggulannyamenit65.AsisstViniciusJuniordisambutdengansepakanmendatarolehKarimBenzemayangtakmampudihalaukiperFrankfurt,KevinTrapp.KuasahukumkeluargaBrigadirJatauNofryansahYosuaHutabarat,KamaruddinSimanjuntak(kanan)danJohnsonPanjaitandiBareskrimPolribeberapawaktuyanglalu.Foto:Ricardojpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangRabu(10/8)tentangsebuahmisterikepemilikansenjatauntukmembunuhBrigadirJterungkap,satudariempattersangkapembunuhanBrigadirJmuncul,hinggaperintahFerdySamboparah.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahBacaJuga:5BeritaTerpopuler:5PengakuanTerbaruBharadaETerungkap,LPSKMendadakBungkam,KomjenAgusMeresponsTegasMisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:5BeritaTerpopuler:BharadaELegaMembongkarKasusBrigadirJ,AdaRahasiaBesarhinggaUrusanCintaBacaselengkapnya,kliklinkdibawah:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahTersangkaMRsaatdiamankandiPolresRejangLebong.Foto:doklinggauposjpnn.com,REJANGLEBONG-JajaranPolresRejangLebongmembongkarkelakuanasliseorangkhatibmasjidberinisialMR(43)diBengkulu.MRyangselamainidikampungnyadikenalsebagaikhatibmasjidternyatapredatoranak.Korbannyaputrinyasendiri.BacaJuga:DiMasjidMRJadiKhatib,SampaidiRumahBerubahMonster,Biadab!BacaJuga:PerbuatanSopirAngkotIniSungguhBikinEmosiTingkatTinggiPriaparuhbayaituternyatatelahmelakukanhalpalingkejiterhadapanaknyasendiriyangmasihberusia9tahun.WargaRejangLebong,Bengkuluitumemerkosaanaknyasendiri,bahkanitusudahdilakukansejak2019lalu.PerbuatankejiterakhiryangdilakukanMRpadaSelasa(9/8)kemarin.BacaJuga:IstrinyaDigoda,MemedBacokAlpian,TempatPijatBanjirDarahAksibejatnyaitudiketahuitetanggasehinggasampaikemejaPolsekBermaniUlu,RejangLebong.KapolresRejangLebongAKBPTonnyKurniawanmenjelaskantersangkaditangkapberdasarakanlaporankorbandidampingitetangga.

Sejumlahpersoneltampaksedangberbaris.Foto:Ricardo/JPNN.jpnn.com,JAKARTA-KepolisianRepublikIndonesia(Polri)memiliki434.135personelyangtersebardiseluruhwilayahnusantara.Setiappolisimemilikipangkatsesuaidenganseleksipendaftarandanberapalamamerekamengabdidikorpsbajucokelat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SistemkepangkataninisudahdiaturdalamPeraturanKapolriNomor3Tahun2016tentangAdministrasiKepangkatanAnggotaKepolisianRepublikIndonesiadalamBabIItentangGolonganKepangkatanPasal3.AdapunjenjangkepangkatanPolriterbagimenjaditiga,pertamaadatamtama,keduabintara,danketigaperwira.BacaJuga:31AnggotaPolisiMelanggarKodeEtikDalamPenangananKasusKematianBrigadirJ,ApakahAdadariKedokteranForensik?TamtamaDimulaidaripangkatterendahadapadajenjangtamtama.1.BhayangkaraDua(Bharada)Iniadalahpangkatterendahdikepolisianketikaseseoranglulusseleksipendaftarantamtamadansudahmenjalanipendidikan.BacaJuga:IniDaftarNama32PolisiBerprestasiPenerimaKenaikanPangkatLuarBiasadariKapolriBentukpangkatbharadainiadalahgarismiringsatu.2.BhayangkaraSatu(Bharatu)ParapemainRealMadridsaatmerayakangelarUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridsuksesmenggondoltrofiUEFASuper2022setelahmenaklukkanEintrachtFrankfurt.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});BermaindiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB,ElRealunggul2-0atastimJermantersebut.DuagolkemenanganMadridlahirlewataksiDavidAlaba(37)danKarimBenzema(65).BacaJuga:UEFASuperCup2022:PermalukanFrankfurt,RealMadridRajaEropaRaihanpositifinitakterlepasdaripenampilangemilangsejumlahpenggawaElReal.Darisekianbanyaknama,adasetidaknyalimapemainyangpalingmenonjol.Siapasajamereka?Simakulasannyaberikutini.1.CasemiroGelandangasalBrasilinimenjadipemutusseranganFrankfurtsebelummenembuspertahananElReal.Total,Casemiromampumelakukansembilantekelsukses,duaintersep,dansatublok.BacaJuga:BosPSMMintaPerubahanJadwalPertandinganLiga1,IniPenyebabnyaTakcumaitu,CasemirojugaaktifmembantuseranganElRealdengancatatan54umpanakuratdari64percobaan.Takayal,WhoScoredmemberinyanilai8,6,yangtertinggidibandingpemainMadridlainnya.2.KarimBenzemaLagidanlagi,Benzemamembuktikanbahwadirinyabelumhabis.StrikergaekasalPrancisitumenunjukkankualitasnyasebagaifinisherulung.

Kankerotak(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Penyebabkankerotakmasihbelumdiketahuisecarapasti.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Namun,terdapatbeberapafaktoryangdidugamembuatseseoranglebihrentanmengalamikankerotak,diantaranyaadanyamutasigenetik,riwayatkankerotakdalamkeluarga,usiatua,danpaparanradiasi.Makananternyatajugabisamenjadifaktorrisikokankerotak.Karenaitu,kitapatutwaspadaketikaakanmengonsumsimakanantertentu.BacaJuga:BenarkahEsBatuBisaMenyembuhkanAsamUrat?Marikenalijenis-jenismakananpenyebabkankerotakberikutini:1.AlkoholKonsumsialkoholberhubungandengantimbulnyabeberapajeniskanker,sepertikankermulut,kankernasofaring,kankeresofagus,kankerpayudara,hinggakankerotak.Risikokankerakanmeningkatapabiladosisalkoholyangdikonsumsiberlebihan,apalagidisertaikonsumsitembakau.BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?Olehkarenaitu,sebaiknyabatasikonsumsialkohol,bahkanbilaperluhindari.2.MakananyangBerjamurBeberapajenisjamur,salahsatunyaAspergillusflavus,mengandungmetabolitaflatoksin.JamurAspergillusflavusdapatmenjadiparasitpadakacang,pohonkacang,danbiji-bijian.IrjenFerdySamboditahandiMakoBrimob.Foto:Ricardo/JPNN.comjpnn.com,JAKARTASELATAN-Penyidiktimkhusus(timsus)PolrimelakukanpemeriksaanperdanaterhadapIrjenFerdySambosebagaitersangkakasusdugaanpembunuhanBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaanterhadapmantanKadivPropamitudilakukandiMakoBrimob,KelapaDua,Depok,hariini,Kamis(11/8).Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFSsebagaitersangkadiMakoBrimob,kataKadivHumasPolriIrjenDediPrasetyokepadawartawan.BacaJuga:KomnasHAMPeroleh5DataRekamanCCTVsoalPenembakandiRumahFerdySambo,Isinya?Selainitu,kataDedi,penyidiktimkhususjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri,JakartaSelatan.PemeriksaankeduadilakukankepadaKMsebagaitersangkadiBareskrim,ujarDedi.Secaraparalel,Dedimenyebut,pihakInspektoratKhusus(Irsus)PolrijugamenjadwalkanmelakukanpemeriksaanterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJayaterkaitkasuspenembakanBrigadirJ,padahariini.BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaDedimenyebutpemeriksaanitudilakukandiMabesPolri.SedangkanIrsus,agendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJaya,jam10.00WIBdiMabesPolri,ucapDedi.

AudiensipengurusGLPGPPPKdenganSesditjenGTKKemendikbudristekNunukSuryani.Foto:DokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-Pemerintahberencanamenerbitkanpetunjukteknis(juknis)rekrutmenpegawaipemerintahdenganperjanjiankerja(PPPK)awalSeptember.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Namundemikian,gurululuspassinggrade(PG)PPPKjustrupesimistisjadwalpenerbitanjuknisituakanmolorlagi.KetuaForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimengungkapkanKementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)memangsudahmenginformasikanagarmenunggujuknisturun.BacaJuga:PemkabBogorAjukanPenambahanFormasiPPPK2022,PalingBanyakuntukGuruSekretarisDitjenGuruTenagaKependidikan(GTK)NunukSuryanibahkanjugamemintaparagurululusPGagartidakmempercayaidataExcelyangberisidaftarnamadanpenempatankarenasemuanyamenunggujuknis.Meskidemikian,kataIswadi,gurululusPGkhawatirjadwalpenerbitanjuknisitumoloraliastidaktepatwaktu.Jujursaja,kamipesimistisakantepatwaktu,karenamasihharusdirapatkandenganpihak-pihakterkait,terangIswadikepadaJPNN.com,Kamis(11/8).BacaJuga:THPGuruPPPKRp6Juta,PNSRp14Juta,KepalaBKNMerespons,BersyukurlahIswadidanrekan-rekannyamakingusarkarenasaatmerekabertanyakapanseleksiPPPK2022dibuka,tidakadajawabandantimelinejugatakdiberikan.Diamendugahalituterkaitdenganpendataanseluruhtenaganon-aparatursipilnegara(non-ASN)yangsementaraberjalandiseluruhdaerah.PutriCandrawathi(kanan)diMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTA-KalimatyangkeluardarimulutPutriCandrawathikepadatimdariLembagaPerlindunganSaksidanKorban(LPSK),masihmenjaditandatanyabesar.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TimLPSKsebelumnyamelakukanasesmenterhadapistrimantanKadivPropamPolriIrjenFerdySamboitudirumahJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.PutrimerupakansalahsatusaksikuncikasuspembunuhanberencanaterhadapYosuaHutabarataliasBrigadirJyangmelibatkanBharadaE.BacaJuga:IstriIrjenFerdySamboPutriCandrawathiKenapaMalu?EdwinTakTahuKonon,peristiwapembunuhanBrigadirJyangdidugadidalangiIrjenSambo,dipicudugaanpelecehanseksualterhadapPutri.MengacupenjelasanWakilKetuaLPSKEdwinPartogiPasaribu,Putrihanyamengucapkankata-katasingkat.Itupun,adasatukatayangdiulangduakaliolehPutri.BacaJuga:KomjenAgusTegaskanBharadaEMengakukarenaKegigihanPenyidikdanTimsus,BukanPengacaraYangterucaphanyaitu;Malu,Mbak.Malu,ucapEdwinPartogimenirukanmengungkapperkataanPutrikepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).Namun,EdwinmengakutidakpahamdengankatamaluyangdimaksudPutriCandrawathi.

Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KepalaDivisiHubunganMasyarakat(KadivHumas)PolriIrjenDediPrasetyomengatakanpemeriksaanterhadapmantanKadivPropamPolriitudilakukandimarkasKomjenAnangRevandoko.Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFS(FerdySambo,red)sebagaitersangkadiMakoBrimob,kataDedidalamketerangannya,Kamis(11/8).BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaJenderalbintangduaitumengatakantimsusjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri.PemeriksaanjugadilakukankepadaKMsebagaitersangkadiBareskrimPolri,kataDedi.Disisilain,InspektoratKhusus(itsus)PolrijugamenjadwalkanpemeriksaanetikterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJaya.BacaJuga:5BeritaTerpopuler:MotifPembunuhanBerencanaBrigadirJTerungkap,1dari4TersangkaMuncul,FerdySamboTernyataPemeriksaandilakukandiMabesPolri.ItsusagendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJayapukul10.00WIBdiMabesPolri,tuturDedi.IstriIrjenFerdySambo,PutriCandrawathi(kanan)saatdidepanMakoBrimobDepok.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenyampaikananalisisperihalkatamaluyangkeluardarimulutPutriCandrawathisaatasesmenolehtimdariLembagaPerlindunganSaksidanKorban(LPSK).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PutrimerupakansalahsatusaksikuncikasuspembunuhanberencanaterhadapBrigadirJyangmelibatkanBharadaEyangdidalangiolehmantanKadivPropamPolriIrjenFerdySambo,suaminyaPutri.Konon,peristiwapembunuhanBrigadirJdipicudugaanpelecehanseksualterhadapPutri.BacaJuga:PutriCandrawathi2KaliBilangMalu,TerkaitMotifPembunuhanBrigadirJ?WakilKetuaLPSKEdwinPartogiPasaribusebelumnyamenyebutPutriCandrawathihanyamengucapkankata-katasingkatsaatasesmen.Yangterucaphanyaitu;Malu,Mbak.Malu,kataEdwinmenirukanucapanPutri.DiapuntidaktahukenapaistriFerdySambobilangmalu.RezaIndragiripunmengungkapanalisisnyasaatdiwawancaraJPNN.com,Kamis(11/8).BacaJuga:IstriFerdySamboMengakuMalu,AnalisisRezaIndragiri:AdaHalBurukSayamalukeluardariorangyangmenganggapdirinyatelahmelakukanbukandiperlakukansesuatuyangburuk,atauketikaorangitumelihatpihaklainmelakukanhalyangburuk,kataReza.LantasadakahkaitankatamaluyangdiucapkanPutriSambodengandugaanMahfudMDbahwamotifpembunuhanBrigadirJmungkinhanyabolehdidengarolehorang-orangdewasa?HinoDutroZEVyangmejengdiGIIAS2022.Foto:Antarajpnn.com,TANGERANG-PTHinoMotorsSalesIndonesia(HMSI)memamerkansejumlahjajaranproduknyadiajangGaikindoIndonesiaInternationalAutoShow(GIIAS)2022diICEBSD,Tangerang,Kamis(11/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});AdapunprodukyangdibawamulaidaritrukkonvesionalhinggabertengalistrikuntukdikenalkankepadapublikdiIndonesia.Kamimenghadirkanberbagaikendaraanuntukmembantuparapengusahaperkebunan,pertambangan,logistik,hinggatransportasi,kataPresidenDirekturHMSIMasatoUchidasaatkonferensipersdiacaratersebut,Kamis.BacaJuga:TrukHinoTerguling,8TonMinyakGorengTumpahJadiKayakBeginiDiamenambahkantruklistrikyangdiberinamaHinoDutroZEVitumenggunakantipebateraiLithiumIondengankapasitas40kWhuntukpenyalurantenagakemotorlistrik.HinoDutroZEVmenggunakantipenormalchargingACtype1denganwaktu5jamatauquickchargingDCCHAdeMohanyadalamsatujam.Dalamkeadaanbateraipenuhtrukitubisamenempuhjaraklebihdari100kmdanmemilikidayaangkuthinggasatuton.BacaJuga:HinoIndonesiaPastikanSemuaJajaranTrukdanBusSudahStandarEuro4Kemudian,HinojugamemperkenalkaninovasiprodukHino200Seriesyangmemilikitenaga144PS/3.400rpmdenganmesinEuro4dantransmisi5percepatan.Trukitusangattepatuntukbisnispengirimansehari-haridenganjarakpendekdanmenembusjalansempit.InstitutSainsdanTeknologiNasional(ISTN) menawarkanbeasiswabagimahasiswasehinggabisakuliahgratissampaiselesai.FotodokumentasiISTNjpnn.com,JAKARTA-InstitutSainsdanTeknologiNasional(ISTN)membukapendaftaranbeasiswakuliahpenuhempattahundanprogramkeringanan50persen.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});BeasiswaempattahunpenuhmerupakanpengabdianISTNyangsudahberdirisejak1950kepadamasyarakatdalammengimplementasikanPancasilamencerdaskankehidupanbangsa.KepalaLembagaKomunikasiPublikdanPemasaran(LKPP)ISTNTaufikHidayat,ST,MTmengatakanprogrambeasiswaempattahuninimenyediakanuntukprogramstudimatematikadanfisikayangpendaftarannyadilakukansecaraonline.BacaJuga:ISTNMendapatkanDanaHibahPenelitiandariKemendikbudristekPesertayangmengikutiprograminiakanbebasuangkuliahselamaempattahunatausampailulusselamamengikutisyaratdanketentuanyangberlaku.PerkuliahanakandimulaipadaSeptemberyangmanapendaftaranbeasiswainiberlakusampaidenganAgustus2022,kataTaufikHidayatdalamketerangannya,Kamis(11/8).DiamengungkapkanperanISTNsebagailembagapendidikanyangsalahsatutugasnya,yaitupengabdiankepadamasyarakat.BacaJuga:ISTNKembaliMeluluskan421SarjanaTangguhTaufikberharapdariprogrambeasiswainisalahsatunya,yaitubentukpengabdianmasyarakatISTNselakulembagapendidikan,terlebihlagidimasapandemiyangmenyebabkanbanyakorangterkenadampakdaripandemiini.Programkeringanan50persen,lanjutTaufik,merupakanupayaISTNyangmemilikiakreditasiBBAN-PTsebagailembagapendidikandalammendukungprogrampemerintahdalammemberikanbantuanpendidikanterutamadimasapandemi.

AnakbuahIrjenFadilditahanditempatkhususdiMakoBrimobseusaidiperiksaItsusPolribuntutkasustewasnyaBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-InspektoratKhusus(Itsus)PolritelahmemeriksapenyidikPoldaMetroJayayangdidugamelakukanpelanggaranetikbuntutpenanganankasustewasnyaBrigadirNofryansahYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaanterhadapanakbuahIrjenFadilImranberpangkatAKBPitudigelardiBareskrimPolripadahariini,Kamis(11/8)pukul10.00WIB.ItsussudahperiksasatupenyidikPoldaMetroJaya,kataKadivHumasPolriIrjenDediPrasetyodiMakoBrimob,KelapaDua,DepokpadaKamis(11/8)malam.BacaJuga:IrjenDediSebut31PolisiLanggarKodeEtikOlahTKPKematianBrigadirJHasilpemeriksaanitu,Itsusmemutuskanuntukmenahanpenyidiktersebutpadatempatkhusus(Patsus)diMakoBrimob.Kendatidemikian,IrjenDeditakmemerinciidentitaspenyidikberpangkatAKBPitu.Darihasilriksa,langsungditempatkanditempatkhsuusMakoBrimob.Soreini(penyidikyangdiperiksa,red)berpangkatAKBPditaruhdiPatsus,ujarDedi.BacaJuga:BeredarRekamanCCTVMenyangkutPembunuhanBrigadirJ,IrjenDediBilangBeginiDalamkasusini,BharadaEmenembakmatiBrigadirJdiDurenTiga,JakartaSelatanpadaJumat(8/7).BharadaEmenembakmatiBrigadirJatasperintahIrjenFerdySambo.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-EksKadivPropamPolriIrjenFerdySambomengucapkanpermintaanmaafkepadarekansejawatnyadiPolri,keluarga,danmasyarakatyangterdampakdaripolemikdalamkasuspembunuhanNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PermohonanmaafdariIrjenFerdySamboitusepertidisampaikanpengacaranya,ArmanHaniskepadaawakmediadiJakarta,Kamis(11/8).Secaratulusmemintamaafdanmemohonmaaf,kataArmanmembacakansuratpermohonanmaafdariIrjenFerdySambo.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniEksDirekturTindakPidanaUmumBareskrimitusadarpolemikdalamkasustewasnyaBrigadirJbermuaradariperbuatannyayangmemberikaninformasitidakbenar.Memberikaninfomasiyangtidakbenarsertamemicupolemik,ujarnya.IrjenFerdySamboberjanjiakanpatuhdanmengikutisetapproseshukumyangsaatinisedangberjalanataunantidipengadilan.BacaJuga:IrjenFerdySamboMintaMaafkeKapolriHinggaMasyarakat,TetapiTidakMemuatKeluargaBrigadirJAkansayapertanggungjawabkan,ungkapalumnusAkpol1994itu.IrjenFerdySambodalamsuratnyakemudianmengakuhanyaberupayamenjagadanmelindungimuruahkeluargasehinggadirinyaterlibatdalamkasustewasnyaBrigadirJ.

PakarpsikologiforensikRezaIndragiripunyaanalisistentangkatamaluyangdiucapkanistriFerdySambo.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielpunyaanalisismenariktentangkatamaluyangkeluardarimulutPutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KataitusebelumnyadisampaikanistriFerdySambotersebutketikaberhadapandengantimasesmendariLembagaPerlindunganSaksidanKorban(LPSK).DemiAllah.Saatmenontonlive-nyawaktu(Putri)munculdidepanMakoBrimob,sayamembatin,inimenahansedihataumenahanmalu?jawabRezasaatberbincangdenganJPNN.com,Kamis(11/8).BacaJuga:PutriCandrawathi2KaliBilangMalu,TerkaitMotifPembunuhanBrigadirJ?RezaIndragirilantasmenyampaikananalisisbahwaperasaanmalubisadipilahkedalamduaragam.Pertama,malusebagaiperasaantidaknyamanyangmunculketikasisidiriatauperbuatanseseorangtereksposkepihaklaindanitumerusakcitrayanginginorangtersebutbangun.Sisidiriatauperbuatanitubersifatumumbelaka.Misalnya,ngupil,ucappenyandanggelarMCrim(Forpsych-masterpsikologiforensik)dariUniversitasofMelbourneAustraliaitu.BacaJuga:PolisiPerluUsutKeterlibatanFahmiAlamsyah,BisaDijeratPasalPermufakatanJahatMenurutdia,ngupilpadadasarnyabagus,yaknibentukpedulipadakesehatandengancaramengorekhidungagarbersihdarikotoran.namun,ketikaaktivitasituternyatadilihatpihaklain,malahmunculsensasisayamelakukankegiatanyangkotor.Ngupilnyasebetulnyabagus,tetapimenjadijelekkarenadilihatolehpihaklain.Iniadalahembarrasement.Diindonesiakansepadandenganmalu,terangnya.PengacaraHotmanParis.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-DuniaentertainmentJPNNsepanjangJumat(11/8)diramaikandenganpernyataanHotmanParisHutapeasoalkasusBrigadirJ.PengacaranyentrikinimenyorotilaporanistriFerdySambo,PutriCandrawathisoaldugaanpelecehanseksual.HotmanlantasmemberisindiranpedasuntukPutriCandrawathi,terkaitkasusdugaanpelecehandankematianBrigadirJ.BacaJuga:HotmanParisSebutIstriIrjenFerdySambosudahMenangisdariMagelang,AdaApa?Selainitu,penyukaberliandanmobilmewahinimakinpenasarandenganmotifBharadaEyangmenembakmendiangBrigadirJ.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.KasusDugaanPelecehanHotmanmengakupenasaranlantaranistriIrjenFerdySamboitumasihngototmelanjutkankasustersebut.BacaJuga:HotmanParisAkanTerusMemburuRazmandanTeman-temannya,Siap-Siap!Kan,yangdidugapelakualmarhum,kan,sudahmeninggalberartikasusselesai,kataHotmanparis.Bacaselengkapnya:IstriFerdySamboNgototLanjutkanKasusDugaanPelecehan,HotmanParisBilangBegini

WingerTimnasIndonesiaEgyMaulanaVikrisaatberlatihbersamaFKSenica.Foto:Twitter/Egymv1jpnn.com,ZLATEMORAVCE-AdasejumlahalasanyangmembuatFCViONZlateMoravcetertarikmemboyongEgyMaulanaVikri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Melansirtransfermarkt,klubasalSlovakiaitumengikatEgydengankontrakberdurasisatutahun.ManajerZlateMoravce,MarekOndrejkaengganmenyebutkehadiranEgyhanyabagiandaristrategipemasaran.BacaJuga:EgyMaulanaDikontrak1Tahun,WitanLebihLama,BeginiHarapanSangAgenBukanrahasiaumumapabilapemainasalIndonesiadatang,klubakankebanjiraneksposure.Namun,Ondrejkamembantahitudanmenyebuttimnyabenar-benarmembutuhkansosokEgydiataslapangan.KamimengagumikreativitasdanvariasiseranganyangdimilikiEgy.Diajugamemilikikemampuanbagussaatduelsatulawansatu.BacaJuga:EfekEgyMaulanaVikri,PengikutFCViOnZlateMoravceLampauiPopulasiKotanyaDiahadiruntuksepakbola,pemasaranhanyabagiandaribonus,ujarOndrejkadilansirdarilamanresmiklub.Kendatidemikian,Ondrejkatakmembantahpemasaranyangbagusakanmemberikanefekpositifbagiklub.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-EksKadivPropamPolriIrjenFerdySambomengutarakanmotivasidanniatnyadibalikkasuspembunuhanNofriansyahYoshuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});ApayangdilakukanFerdyitu,semata-matahanyainginmenjagadanmelindungimuruahkeluarga.PengakuanFerdyitutertuangdalamsuratpernyataanyangdibacakanpengacaranya,ArmanHaniskepadaawakmediadiJakarta,Kamis(11/8).BacaJuga:IrjenFerdySamboBikinSurat,DibacakanPengacaranya,SinggungSoalNiatNiatsayauntukmenjagadanmelindungimaruahsertakehormatankeluargayangsangatsayacintai,ujardia.Terlepasdariitu,alumnusAkpol1994itumenyampaikanpermintaanmaafkepadarekansejawatnyadiPolri,keluarga,danmasyarakatyangterdampakdaripolemikdalamkasuspembunuhanBrigadirJ.Secaratulusmemintamaafdanmemohonmaaf,kataArman.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniEksDirekturTindakPidanaUmumBareskrimitusadarpolemikdalamkasustewasnyaBrigadirJbermuaradariperbuatannyayangmemberikaninformasitidakbenar.Memberikaninfomasiyangtidakbenarsertamemicupolemik,ujarnya.

MantanKadivPropamPolriIrjenFerdySambotersangkakasuspembunuhanberencanaterhadapBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MotifpembunuhanterhadapBrigadirNofryansahYosuaHutabarataliasBrigadirJakhirnyaterkuak.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidamaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutmotifpembunuhanitukarenaIrjenFerdySambomerasaemosidanmarahkepadaBrigadirJ.Sebab,PutriCandrawathidilukaiharkatdanmartabatnyaolehBrigadirJ.BacaJuga:IrjenFerdySamboBikinSurat,DibacakanPengacaranya,SinggungSoalNiatFaktaituterungkapsetelahtimkhusus(timsus)memeriksaIrjenFerdySambosebagaitersangkadiMakoBrimob,KelapaDua,Depok,Kamis(11/8).DalamketerangannyatersangkaFS(FerdySambo,red)mengatakanbahwadirinyamenjadimarahdanemosisetelahmendapatlaporandariistrinyaPC(PutriCandrawathi,red)yangtelahmengalamitindakanyangmelukaiharkatdanmartabatkeluarga,kataBrigjenAndidiMakoBrimobKelapaDua,Kamis(11/8).TindakanyangdilakukanBrigadirJterhadapPutriCandrawathiituterjadidiMagelang.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniJenderalbintangsatuitumengatakanmengatakanketeranganFerdySambotersebuttelahdituangkandalamberitaacarapemeriksaan(BAP).ItupengakuantersangkadiBAP,ujaralumnusAkpol1991itu.PengacaraRazmanArifNasution.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraRazmanArifNasutionmenyindirHotmanParismelaluiakunnyadiInstagram.HalitusehubungandenganHotmanParisyangmemprediksikasuskematianBrigadirJsertamemberikanmasukanuntukBharadaE.RazmanNasutionlantasmenyindirapakahrivalnyaitusudahbergantiprofesilantaranmembuatprediksisepertiitu.BacaJuga:WendiCagurBanjirPujianGegaraRokAyuTingTingSobekIniorangsudahjadiperamalya?Atausudahmerangkapperamaldanpengacara?ujarRazmandikutipKamis(11/8).DiajustrumemintapengacaraBharadaEagarberhati-hatidenganucapanHotmanParis.SebabdiamendugaHotmanmemilikiniatlaindibaliksikapnyatersebut.BacaJuga:SorotiWajahHotmanParis,RazmanNasution:KeracunanObatAtauBisajadiiniupayadiauntukmencarisimpatipihakkeluargaBharadaEseolah-olahHotmanParisyangpalingpahamakanupayapembelaanhukumterhadapBharadaE,kataRazmanNasution.Sebelumnya,HotmanParisternyatasempatmemprediksisoaladanyatersangkabarudalamkasuskematianBrigadirJ.DahlanIskan(Disway).Foto:Ricardo/JPNN.comjpnn.com-MEDIAinilahyangharusdicatatsebagaipembukaperistiwaDurenTiga.Mediamainstream.Kalautidak,bisajadiperistiwaituterkuburmungkinuntukselama-lamanya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});MediaituadadiJambi.Wartawanitusebenarnyatelattahu:adapolisi,asalJambi,yangmatitertembak.Sudahduaharisebelumnya.Wajartelat.Rumahpolisiitudipedalaman.Sangkorbanjugadikuburdipedalamanitu.Kurangbisamenarikperhatianseketika.BacaJuga:KepungCendolSiwartawanlantaskePoldaJambi.HumasPoldatidaktahu.IamemintaSiwartawankeKabidPropam.MungkinbidangPropamyangtahu.InikanmenyangkutanggotaPolri.Namun,PropamPoldaJambijugatidaktahu.Tidakbisamenjawab.MakaPropamJambimenanyakanitukePropamMabesPolri.FerdySambopunambilkesimpulan:berartiperistiwaDurenTigasudahdiketahuimedia.Tidakbisalagiditutupi.Harusdisiapkanjawabanyangtepat.Yangbisamembantumenyusunjawabanituharusorangyangmemahamimedia.BacaJuga:LabirinPolkamIrjenFerdySambotidaksulitmencariorangyangpunyakualifikasidekatdenganmedia.Iajugasosokyangaman.Tepercaya.IapenasihatahliKapolri,bidangkomunikasipublik.MakaJenderalSambomeneleponSangpenasihatmedia:FahmiAlamsyah.SejumlahpersonelBrimobbersenjatalengkapsaatberjagadirumahpribadiIrjenFerdySambo,JalanSagulingIII,KomplekPertambangan,DurenTiga,JakartaSelatan,Selasa(9/8/2022).Foto/dok:Ricardo/JPNNjpnn.com,JAKARTA-DahlanIskanmengungkapsosokyangdihubungiIrjenFerdySambosetelahkematianYosuaHutabarataliasBrigadirJdiketahuiwartawanmediamainstream.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});CeritayangdiperolehkolumniskondangitudituangkandalamtulisanDiswayedisiJumat(12/8).DalamtulisanituDahlanmenjelaskanawalkematianBrigadirJterungkapkepubliksetelahterciumolehwartawanmediamainstreamdiJambi.BacaJuga:InikahSebabMediaTelatTahusoalInsidendiRumahFerdySambo?Kalautidak,bisajadiperistiwaituterkuburmungkinuntukselama-lamanya,tulisDahlandalamtulisanberjudulBintangWanita.Konon,wartawanyangmengetahuikematianBrigadirJmengonfirmasinyakepadahumasPoldaJambi.Namun,karenapolisididaerahitutidakmengetahuikejadiannya,pihakPoldaJambipunbertanyakeMabesPolri.BacaJuga:UcapanMaluPutriSambodanKonten17TahunkeAtas,HmmmSingkatcerita,FerdySambomengambilkesimpulan:berartiperistiwaDurenTigasudahdiketahuimedia.Tidakbisalagiditutupi,sambungtulisanDahlan.

SkuadVietnamU-16saatberlagadiPialaAFFU-162022.Foto:Twitter/AFFPressejpnn.com,YOGYAKARTA-PelatihVietnamNguyenQuocTuanungkapketakutantersebarnyasaatjumpaTimnasU-16IndonesiadifinalPialaAFFU-162022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Nguyensedikitkhawatirdenganterorsuportertuanrumah.Bukantanpaalasan,sangjurutaktikmenjadisaksisaatkipercadanganVietnamdilemparibotololehsuporter.BacaJuga:FinalPialaAFFU-162022:VietnamDiterpaKabarBurukJelangJumpaIndonesiaDukungansuporter(diIndonesia,red)terkadangterlaluliar.Ituyangmembuatkamikesulitan,ucapNguyen.Kendatidemikian,Nguyenmengakutimnyasudahsiapdengansegalatekanandanterordarisuporter.Sayasudahsiapkanmentalpemainagarmerekapercayadiri,imbuhdia.BacaJuga:BukanTrikPemasaran,TernyataIniAlasanFCViONZlateMoravceBoyongEgyMaulanaBimaSaktidisisilain,memintasuportermemberikandukungankepadaTimnasU-16Indonesiasecaradewasa.Dukungkamisecarafairdansportif.Kitaharusrespekdengansemualawan,ucapBima.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-BareskrimPolrimenyebutBhayangkaraDuaRichardEliezeratauBharadaEtelahmencabutsuratkuasaterhadapkeduakuasahukumnya,DeolipaYumaradanBurhanuddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianmengatakanpencabutankuasatersebutdilakukanBharadaEpadaRabu(10/8).Pengacarabukanmengundurkandiri,tetapikuasasipengacaradicabutolehsipemberikuasa,kataAndisaatdikonfirmasi,Jumat(12/8).BacaJuga:IniSosokKM,1dari4TersangkaKasusPembunuhanBerencanaBrigadirJ,TernyataJenderalbintangsatuitumengatakanDeolipadanBurhanuddinmerupakansenjatinyapengacarayangditunjukpenyidikgunamendampingisaatpemeriksaan.MerekapengacaraditunjukolehpenyidikuntukmendampingiBharadaREdalampemeriksaanpasca-pengacaraawalyangditunjukolehtersangkaFSuntukBharadaREmengundurkandiri,ujarAndi.BrigjenAndimenyebutBharadaEtelahmenunjukpengacaralainsebagaipenggantiDeolipadkk.BacaJuga:FerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretKendatidemikian,Andibelummemerincisiapapenggantinya.Sebelumnya,beredarsuratyangmenyebutkanBharadaEmencabutkuasanyaterhadapDeolipadanBurhanuddin.

IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-IrjenFerdySambomenulissebuahsuratdariMakoBrimob.IsisurattersebutdibacakanpengacaramantanKepalaDivisiProfesidanPengamanan(KadivPropam)Polri.FerdySambomengakupolemikkasuskematianajudannya,BrigadirJitubermuaradariperbuatannyayangmemberikaninformasitidakbenar.BacaJuga:MengapaFerdySamboHubungiSosokIniSetelahKematianYosuaTakBisaDitutupi?Memberikaninfomasiyangtidakbenarsertamemicupolemik,katapengacaraFerdySambo,ArmanHanis.FerdySambomemintamaafkepadaseluruhpihakyangterdampakpolemikkasuspembunuhanBrigadirJ.Namundemikian,IrjenFerdySambomenunjukkansikapkesatriadenganberjanjiakanpatuhdanmengikutisetiapproseshukumyangsaatinisedangberjalanataunantidipengadilan.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanAkansayapertanggungjawabkan,ungkapalumnusAkpol1994itu.Selainitu,dikatakanArmanHanis,eksDirekturTindakPidanaUmumBareskrimitumenyampaikanpermintaanmaaf.KetuaKomnasHAMRIAhmadTaufanDamanik.Foto:Ricardojpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)telahmemeriksamantanKadivPropamIrjenFerdySambodiMakoBrimob,Depok,Jumat(12/8)sore.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaantersebutdalamkapasitasSambosebagaitersangkakasuspenembakanyangmenewaskanBrigadirYosuaHutabaratatauJ.KetuaKomnasHAMAhmadTaufanDamanikmengatakanpemeriksaantersebutdilakukandalamsaturuangankhususyangberisidirinya,IrjenSambo,KomisionerKomnasHAMBekaUlungHapsara,danChoirulAnam.BacaJuga:IrjenFerdySamboMengakuiPalingBertanggungJawabatasKematianBrigadirJMenurutTaufan,dalampermintaanketeranganataupemeriksaantersebut,adabeberapahalyangdiperoleh.PertamaadalahpengakuansaudaraFSbahwadiaaktorutamadariperistiwaini.FSmengakuisejakawaldialahyangmelakukanlangkah-langkahuntukmerekayasa,mengubah,ataumendisinformasibeberapahal,ucapTaufan.AkibatrekayasaIrjenSambotersebut,skenarioawalnyaterbanguninsidentembakmenembakyangmelibatkanBrigadirJdanBharadaE.BacaJuga:WahaiKapolri,IniSikapPakJokowisoalMisteriMotifPembunuhanBrigadirJNamunkemudiandiakuinyaituhasilrancanganFSsendiridanmengakuibahwadiabersalahdalamtindakannya,ucapDamanikPatiYanmaitupunmenyampaikanpermintaanmaafkepadasemuapihaktermasukKomnasHAMdanmasyarakatIndonesiaatastindakannya.

PTJasaRaharja.Foto:dokJasaRaharjajpnn.com,SURABAYA-PTJasaRaharjasuksesmenggelarRoadSafetyRangerKidsbertajukLindungiAnakdalamPerjalanannyadiDyandraConventionCenter,Surabaya,JawaTimurpadaSabtu(6/8.)googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Kegiatanitudiikuti400pesertayangterdiridarisiswa-siswiSekolahDasar(SD)diwilayahKotaSurabaya.DirekturHubunganKelembagaanPTJasaRaharjaMunadiHerlambangmengatakan,kegiatantersebutbertujuanuntukmenanamkankedisiplinanberlalulintaskepadaanak-anak.BacaJuga:AdabTiduryangDisarankanDalamAjaranIslamParaorangtua,biasanyalebihpatuhkalaudiingatkanolehanaknyasendiridaripadasamaoranglain,ujarMunadidiselakegiatantersebut.Munadimenegaskankedisiplinanberlalulintassangatpentinguntukditanamkansejakdini.Dengandemikian,diharapkanakanterbentukgenerasimudayangberkeselamatandanmenjadipeloporkeselamatanberlalulintasdijalanraya.BacaJuga:MenteriESDMBakalTertibkanRKABBuramTambangTimahPenanamankedisiplinanberlalulintasbagiusiadini,akanlebihefektifjikadiberikansemenarikmungkin.Olehsebabitu,agendaRoadSafetyRangerKids,jugadigelardengankonsepfun.Disinianak-anakbisamenikmatisuasanatamanlalulintassambilmempelajariaturan-aturanberkendara,jugaaturanpejalankakidijalanmelaluipos-pospermainan.Sehinggamerekatidakhanyaterhibur,namunjugamendapatpembelajaranpentingdalamberlalulintas,paparMunadi.Waspadacuacabesok,Sabtu.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-BadanMeteorologi,Klimatologi,danGeofisika(BMKG)memprediksicuacacerahhinggahujandisertaipetirterjadidisejumlahkotabesarIndonesia,Sabtu(13/8)besok.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PrakirawanBMKGIdhanAbubakarmengatakancuacabesokdiwilayahSumatra,seperti,Pekanbaru,TanjungPinang,Pangkalpinang,danPalembangdiprediksihujanringan.CuacadiJambidanBandarLampungdiprediksihujandisertaipetirsertaPadangberkabut.BacaJuga:BMKGBeberkanDataCuacaTujuhHariMendatangdiNTBSelanjutnya,cuacadiBengkuludanMedandiprakirakanberawansertaBandaAcehcerah.AdapununtukwilayahJawa,sepertidiSerang,DKIJakarta,Bandung,danSurabayadiprakirakancuacanyahujanringan.CuacadiSemarangdiprediksihujansedangsertaYogyakartaberawan.BacaJuga:RaisaAkanMencetakSejarahdiGBKCuacabesokdiwilayahKalimantan,sepertidiTanjungSelordanSamarindadiprediksihujanringansertaPalangkarayahujansedang,kataIdhan,Jumat(12/8).CuacadiPontianakdanBanjarmasindiprakirakanhujandisertaipetir,sambungIdhan.

Iklan Bawah Artikel